ZNF516 polyclonal antibody
  • ZNF516 polyclonal antibody

ZNF516 polyclonal antibody

Ref: AB-PAB20848
ZNF516 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF516.
Información adicional
Size 100 uL
Gene Name ZNF516
Gene Alias HsT287
Gene Description zinc finger protein 516
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CCFSEEVTSTELSSGDQSHKMGDNASERDTGESKAGIAASVSILENSSRETSRRQEQHRFSMDLKMPAFHPKQEVPVPGDGVEFPSSTGAEGQTGHPAEKLSDLH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF516.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9658
Iso type IgG

Enviar uma mensagem


ZNF516 polyclonal antibody

ZNF516 polyclonal antibody