B4GALNT2 polyclonal antibody
  • B4GALNT2 polyclonal antibody

B4GALNT2 polyclonal antibody

Ref: AB-PAB20841
B4GALNT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant B4GALNT2.
Información adicional
Size 100 uL
Gene Name B4GALNT2
Gene Alias B4GALGT2|B4GALT|Cad|GALGT2|MGC142235|MGC142237|SD|Sda
Gene Description beta-1,4-N-acetyl-galactosaminyl transferase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human B4GALNT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124872
Iso type IgG

Enviar uma mensagem


B4GALNT2 polyclonal antibody

B4GALNT2 polyclonal antibody