WNT7A polyclonal antibody
  • WNT7A polyclonal antibody

WNT7A polyclonal antibody

Ref: AB-PAB20839
WNT7A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WNT7A.
Información adicional
Size 100 uL
Gene Name WNT7A
Gene Alias -
Gene Description wingless-type MMTV integration site family, member 7A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WNT7A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7476
Iso type IgG

Enviar uma mensagem


WNT7A polyclonal antibody

WNT7A polyclonal antibody