FAM69A polyclonal antibody
  • FAM69A polyclonal antibody

FAM69A polyclonal antibody

Ref: AB-PAB20838
FAM69A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM69A.
Información adicional
Size 100 uL
Gene Name FAM69A
Gene Alias FLJ23493
Gene Description family with sequence similarity 69, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQPNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM69A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388650
Iso type IgG

Enviar uma mensagem


FAM69A polyclonal antibody

FAM69A polyclonal antibody