TMEM74 polyclonal antibody
  • TMEM74 polyclonal antibody

TMEM74 polyclonal antibody

Ref: AB-PAB20836
TMEM74 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM74.
Información adicional
Size 100 uL
Gene Name TMEM74
Gene Alias FLJ30668
Gene Description transmembrane protein 74
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWENPNEW
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM74.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157753
Iso type IgG

Enviar uma mensagem


TMEM74 polyclonal antibody

TMEM74 polyclonal antibody