GDF5 polyclonal antibody
  • GDF5 polyclonal antibody

GDF5 polyclonal antibody

Ref: AB-PAB20833
GDF5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GDF5.
Información adicional
Size 100 uL
Gene Name GDF5
Gene Alias BMP14|CDMP1|LAP4|SYNS2
Gene Description growth differentiation factor 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RYVFDISALEKDGLLGAELRILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPASLLDVRSVPGLDGSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDL
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GDF5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8200
Iso type IgG

Enviar uma mensagem


GDF5 polyclonal antibody

GDF5 polyclonal antibody