APOBEC4 polyclonal antibody
  • APOBEC4 polyclonal antibody

APOBEC4 polyclonal antibody

Ref: AB-PAB20830
APOBEC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APOBEC4.
Información adicional
Size 100 uL
Gene Name APOBEC4
Gene Alias C1orf169|MGC26594
Gene Description apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NFLITYPGITLSIYFSQLYHTEMDFPASAWNREALRSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSHVFQPILTGRALADRHNAYEINAITGVKPYFTDVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQPNLPPDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APOBEC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 403314
Iso type IgG

Enviar uma mensagem


APOBEC4 polyclonal antibody

APOBEC4 polyclonal antibody