TIMD4 polyclonal antibody
  • TIMD4 polyclonal antibody

TIMD4 polyclonal antibody

Ref: AB-PAB20827
TIMD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TIMD4.
Información adicional
Size 100 uL
Gene Name TIMD4
Gene Alias FLJ27515|SMUCKLER|TIM4
Gene Description T-cell immunoglobulin and mucin domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TIMD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91937
Iso type IgG

Enviar uma mensagem


TIMD4 polyclonal antibody

TIMD4 polyclonal antibody