TBC1D15 polyclonal antibody
  • TBC1D15 polyclonal antibody

TBC1D15 polyclonal antibody

Ref: AB-PAB20818
TBC1D15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBC1D15.
Información adicional
Size 100 uL
Gene Name TBC1D15
Gene Alias DKFZp686M1379|DKFZp761D0223|FLJ12085
Gene Description TBC1 domain family, member 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRVLEKDAEVIVDWRPLDDALDSSSILYARKDSSSVVEWTQAPKERGHRGSEHLNSYEAEWDMVNTVSFKRKPHTNGDAPSHRNGKSKWSFLFSLTDLKSIKQNKEGMGWSYLVFCLKDDVVLPALHF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64786
Iso type IgG

Enviar uma mensagem


TBC1D15 polyclonal antibody

TBC1D15 polyclonal antibody