STXBP2 polyclonal antibody
  • STXBP2 polyclonal antibody

STXBP2 polyclonal antibody

Ref: AB-PAB20815
STXBP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STXBP2.
Información adicional
Size 100 uL
Gene Name STXBP2
Gene Alias Hunc18b|MUNC18-2|UNC18-2|UNC18B|pp10122
Gene Description syntaxin binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKLN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STXBP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6813
Iso type IgG

Enviar uma mensagem


STXBP2 polyclonal antibody

STXBP2 polyclonal antibody