LRIG2 polyclonal antibody
  • LRIG2 polyclonal antibody

LRIG2 polyclonal antibody

Ref: AB-PAB20814
LRIG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRIG2.
Información adicional
Size 100 uL
Gene Name LRIG2
Gene Alias DKFZp451C181|KIAA0806|LIG2
Gene Description leucine-rich repeats and immunoglobulin-like domains 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRVICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESLIPSANREPSAFPTNHERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESPQLHQNEGLAGREPDCSASSMSCHRLQDHAF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRIG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9860
Iso type IgG

Enviar uma mensagem


LRIG2 polyclonal antibody

LRIG2 polyclonal antibody