LRIG2 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant LRIG2.

AB-PAB20814

New product

LRIG2 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name LRIG2
Gene Alias DKFZp451C181|KIAA0806|LIG2
Gene Description leucine-rich repeats and immunoglobulin-like domains 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRVICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESLIPSANREPSAFPTNHERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESPQLHQNEGLAGREPDCSASSMSCHRLQDHAF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRIG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9860
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant LRIG2.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant LRIG2.

Rabbit polyclonal antibody raised against recombinant LRIG2.