ZBTB11 polyclonal antibody
  • ZBTB11 polyclonal antibody

ZBTB11 polyclonal antibody

Ref: AB-PAB20810
ZBTB11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZBTB11.
Información adicional
Size 100 uL
Gene Name ZBTB11
Gene Alias FLJ13426|MGC133303|ZNF-U69274
Gene Description zinc finger and BTB domain containing 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KKGEVQTVASTQDLRVQNGGTAPPVASSEGTTTSLPTELGDCEIVLLVNGELPEAEQNGEVGRQPEPQVSSEAESALSSVGCIADSHPEMESVDLITKNNQTELETSNNRENNTVSNIHPKLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZBTB11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27107
Iso type IgG

Enviar uma mensagem


ZBTB11 polyclonal antibody

ZBTB11 polyclonal antibody