ZNF532 polyclonal antibody
  • ZNF532 polyclonal antibody

ZNF532 polyclonal antibody

Ref: AB-PAB20809
ZNF532 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF532.
Información adicional
Size 100 uL
Gene Name ZNF532
Gene Alias FLJ10697
Gene Description zinc finger protein 532
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RRTFTKRLMLEKHVQLMHGIKDPDLKEMTDATNEEETEIKEDTKVPSPKRKLEEPVLEFRPPRGAITQPLKKLKINVFKVHKCAVCGFTTENLLQFHEHIPQHKSDGSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF532.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55205
Iso type IgG

Enviar uma mensagem


ZNF532 polyclonal antibody

ZNF532 polyclonal antibody