SLC30A1 polyclonal antibody
  • SLC30A1 polyclonal antibody

SLC30A1 polyclonal antibody

Ref: AB-PAB20806
SLC30A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC30A1.
Información adicional
Size 100 uL
Gene Name SLC30A1
Gene Alias ZNT1|ZRC1
Gene Description solute carrier family 30 (zinc transporter), member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC30A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7779
Iso type IgG

Enviar uma mensagem


SLC30A1 polyclonal antibody

SLC30A1 polyclonal antibody