GPRC5B polyclonal antibody
  • GPRC5B polyclonal antibody

GPRC5B polyclonal antibody

Ref: AB-PAB20805
GPRC5B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPRC5B.
Información adicional
Size 100 uL
Gene Name GPRC5B
Gene Alias RAIG-2|RAIG2
Gene Description G protein-coupled receptor, family C, group 5, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPRC5B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51704
Iso type IgG

Enviar uma mensagem


GPRC5B polyclonal antibody

GPRC5B polyclonal antibody