FCGRT polyclonal antibody
  • FCGRT polyclonal antibody

FCGRT polyclonal antibody

Ref: AB-PAB20797
FCGRT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FCGRT.
Información adicional
Size 100 uL
Gene Name FCGRT
Gene Alias FCRN|alpha-chain
Gene Description Fc fragment of IgG, receptor, transporter, alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FCGRT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2217
Iso type IgG

Enviar uma mensagem


FCGRT polyclonal antibody

FCGRT polyclonal antibody