TMEM234 polyclonal antibody
  • TMEM234 polyclonal antibody

TMEM234 polyclonal antibody

Ref: AB-PAB20787
TMEM234 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM234.
Información adicional
Size 100 uL
Gene Name TMEM234
Gene Alias AASL548|FLJ90779|PRO1105|RP4-622L5|dJ622L5.7
Gene Description chromosome 1 open reading frame 91
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPEWVRTRPFPILPFPLQLFCF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM234.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56063
Iso type IgG

Enviar uma mensagem


TMEM234 polyclonal antibody

TMEM234 polyclonal antibody