PDZK1IP1 polyclonal antibody
  • PDZK1IP1 polyclonal antibody

PDZK1IP1 polyclonal antibody

Ref: AB-PAB20782
PDZK1IP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PDZK1IP1.
Información adicional
Size 100 uL
Gene Name PDZK1IP1
Gene Alias DD96|MAP17|RP1-18D14.5|SPAP
Gene Description PDZK1 interacting protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRST
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PDZK1IP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10158
Iso type IgG

Enviar uma mensagem


PDZK1IP1 polyclonal antibody

PDZK1IP1 polyclonal antibody