KCNS3 polyclonal antibody
  • KCNS3 polyclonal antibody

KCNS3 polyclonal antibody

Ref: AB-PAB20779
KCNS3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNS3.
Información adicional
Size 100 uL
Gene Name KCNS3
Gene Alias KV9.3|MGC9481
Gene Description potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNS3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3790
Iso type IgG

Enviar uma mensagem


KCNS3 polyclonal antibody

KCNS3 polyclonal antibody