MPDU1 polyclonal antibody
  • MPDU1 polyclonal antibody

MPDU1 polyclonal antibody

Ref: AB-PAB20774
MPDU1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MPDU1.
Información adicional
Size 100 uL
Gene Name MPDU1
Gene Alias CDGIF|FLJ14836|HBEBP2BPA|Lec35|My008|PP3958|PQLC5|SL15
Gene Description mannose-P-dolichol utilization defect 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MPDU1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9526
Iso type IgG

Enviar uma mensagem


MPDU1 polyclonal antibody

MPDU1 polyclonal antibody