CLPTM1L polyclonal antibody
  • CLPTM1L polyclonal antibody

CLPTM1L polyclonal antibody

Ref: AB-PAB20770
CLPTM1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLPTM1L.
Información adicional
Size 100 uL
Gene Name CLPTM1L
Gene Alias CRR9|DKFZp666M1010|DKFZp761M2324|FLJ14400|FLJ32533
Gene Description CLPTM1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLPTM1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81037
Iso type IgG

Enviar uma mensagem


CLPTM1L polyclonal antibody

CLPTM1L polyclonal antibody