AQP4 polyclonal antibody
  • AQP4 polyclonal antibody

AQP4 polyclonal antibody

Ref: AB-PAB20767
AQP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AQP4.
Información adicional
Size 100 uL
Gene Name AQP4
Gene Alias HMIWC2|MGC22454|MIWC
Gene Description aquaporin 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AQP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 361
Iso type IgG

Enviar uma mensagem


AQP4 polyclonal antibody

AQP4 polyclonal antibody