EMP2 polyclonal antibody
  • EMP2 polyclonal antibody

EMP2 polyclonal antibody

Ref: AB-PAB20757
EMP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EMP2.
Información adicional
Size 100 uL
Gene Name EMP2
Gene Alias MGC9056|XMP
Gene Description epithelial membrane protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EMP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2013
Iso type IgG

Enviar uma mensagem


EMP2 polyclonal antibody

EMP2 polyclonal antibody