SLC22A23 polyclonal antibody
  • SLC22A23 polyclonal antibody

SLC22A23 polyclonal antibody

Ref: AB-PAB20754
SLC22A23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC22A23.
Información adicional
Size 100 uL
Gene Name SLC22A23
Gene Alias C6orf85|DKFZp434F011|FLJ22174
Gene Description solute carrier family 22, member 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PESRDQNLPENISNGEHYTRQPLLPHKKGEQPLLLTNAELKDYSGLHDAAAAGDTLPEGATANGMKAM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC22A23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63027
Iso type IgG

Enviar uma mensagem


SLC22A23 polyclonal antibody

SLC22A23 polyclonal antibody