Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZDHHC5 polyclonal antibody
Abnova
ZDHHC5 polyclonal antibody
Ref: AB-PAB20751
ZDHHC5 polyclonal antibody
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against recombinant ZDHHC5.
Información adicional
Size
100 uL
Gene Name
ZDHHC5
Gene Alias
DKFZp586K0524|KIAA1748|ZNF375
Gene Description
zinc finger, DHHC-type containing 5
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
IHC-P
Immunogen Prot. Seq
DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human ZDHHC5.
Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID
25921
Iso type
IgG
Enviar uma mensagem
ZDHHC5 polyclonal antibody
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*