TMED9 polyclonal antibody
  • TMED9 polyclonal antibody

TMED9 polyclonal antibody

Ref: AB-PAB20749
TMED9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMED9.
Información adicional
Size 100 uL
Gene Name TMED9
Gene Alias HSGP25L2G
Gene Description transmembrane emp24 protein transport domain containing 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMED9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54732
Iso type IgG

Enviar uma mensagem


TMED9 polyclonal antibody

TMED9 polyclonal antibody