TMCO4 polyclonal antibody
  • TMCO4 polyclonal antibody

TMCO4 polyclonal antibody

Ref: AB-PAB20747
TMCO4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMCO4.
Información adicional
Size 100 uL
Gene Name TMCO4
Gene Alias DKFZp686C23231|RP5-1056L3.6
Gene Description transmembrane and coiled-coil domains 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMCO4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 255104
Iso type IgG

Enviar uma mensagem


TMCO4 polyclonal antibody

TMCO4 polyclonal antibody