C9orf123 polyclonal antibody
  • C9orf123 polyclonal antibody

C9orf123 polyclonal antibody

Ref: AB-PAB20745
C9orf123 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf123.
Información adicional
Size 100 uL
Gene Name C9orf123
Gene Alias MGC4730
Gene Description chromosome 9 open reading frame 123
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf123.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90871
Iso type IgG

Enviar uma mensagem


C9orf123 polyclonal antibody

C9orf123 polyclonal antibody