C10orf118 polyclonal antibody
  • C10orf118 polyclonal antibody

C10orf118 polyclonal antibody

Ref: AB-PAB20742
C10orf118 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf118.
Información adicional
Size 100 uL
Gene Name C10orf118
Gene Alias FLJ10188|FLJ35301|MGC118918|MGC129699
Gene Description chromosome 10 open reading frame 118
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LRSSTFPESANEKTYSESPYDTDCTKKFISKIKSVSASEDLLEEIESELLSTEFAEHRVPNGMNKGEHALVLFEKCVQDKYLQQEHIIKKLIKENKKHQELFVDICSEKDNLREELKKRTETEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf118.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55088
Iso type IgG

Enviar uma mensagem


C10orf118 polyclonal antibody

C10orf118 polyclonal antibody