LRRC66 polyclonal antibody
  • LRRC66 polyclonal antibody

LRRC66 polyclonal antibody

Ref: AB-PAB20740
LRRC66 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC66.
Información adicional
Size 100 uL
Gene Name LRRC66
Gene Alias -
Gene Description leucine rich repeat containing 66
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GTEQSLWDSQMEFSKERQVSSSIDLLSIQQPRLSGARAEEALSAHYSEVPYGDPRDTGPSVFPPRWDSGLDVTPANKEPVQKSTPSDTCCELESDCDSDEGSLFTLSSISSESARSKTEEAVPDEESLQDESSGASKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC66.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339977
Iso type IgG

Enviar uma mensagem


LRRC66 polyclonal antibody

LRRC66 polyclonal antibody