RNF130 polyclonal antibody
  • RNF130 polyclonal antibody

RNF130 polyclonal antibody

Ref: AB-PAB20735
RNF130 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNF130.
Información adicional
Size 100 uL
Gene Name RNF130
Gene Alias G1RZFP|GOLIATH|GP|MGC117241|MGC138647|MGC99542
Gene Description ring finger protein 130
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq PWLSEHCTCPMCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRRSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNF130.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55819
Iso type IgG

Enviar uma mensagem


RNF130 polyclonal antibody

RNF130 polyclonal antibody