CLRN3 polyclonal antibody
  • CLRN3 polyclonal antibody

CLRN3 polyclonal antibody

Ref: AB-PAB20731
CLRN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLRN3.
Información adicional
Size 100 uL
Gene Name CLRN3
Gene Alias DKFZp686F11218|MGC32871|TMEM12|USH3AL1
Gene Description clarin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RDSASNGSIFITYGLFRGESSEELSHGLAEPKKKFAVLEILNNSSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLRN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 119467
Iso type IgG

Enviar uma mensagem


CLRN3 polyclonal antibody

CLRN3 polyclonal antibody