PCDHB4 polyclonal antibody
  • PCDHB4 polyclonal antibody

PCDHB4 polyclonal antibody

Ref: AB-PAB20726
PCDHB4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PCDHB4.
Información adicional
Size 100 uL
Gene Name PCDHB4
Gene Alias PCDH-BETA4
Gene Description protocadherin beta 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LCGPIEPCVLHFQVFLEMPVQFFQGELLIQDINDHSPIFPEREVLLKILENSQPGTLFPLLIAEDLDVGSNGLQKYTISPNSHFHILTRNHSEGKKYPDLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PCDHB4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56131
Iso type IgG

Enviar uma mensagem


PCDHB4 polyclonal antibody

PCDHB4 polyclonal antibody