PCNXL2 polyclonal antibody
  • PCNXL2 polyclonal antibody

PCNXL2 polyclonal antibody

Ref: AB-PAB20723
PCNXL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PCNXL2.
Información adicional
Size 100 uL
Gene Name PCNXL2
Gene Alias FLJ11383|KIAA0435
Gene Description pecanex-like 2 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPLHQEVDSSDSEVAVTLIDTSQPGDPLSLHEPIKIVITMSSTPNSMTDLESSLHLRVVGTEKTSVKSDAEPTNPGAAGSPNAEQISIPVITLDLPEGGGGGVPCPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PCNXL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80003
Iso type IgG

Enviar uma mensagem


PCNXL2 polyclonal antibody

PCNXL2 polyclonal antibody