TMEM200A polyclonal antibody
  • TMEM200A polyclonal antibody

TMEM200A polyclonal antibody

Ref: AB-PAB20721
TMEM200A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM200A.
Información adicional
Size 100 uL
Gene Name TMEM200A
Gene Alias KIAA1913|TTMA|TTMC
Gene Description transmembrane protein 200A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM200A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114801
Iso type IgG

Enviar uma mensagem


TMEM200A polyclonal antibody

TMEM200A polyclonal antibody