SDR42E1 polyclonal antibody
  • SDR42E1 polyclonal antibody

SDR42E1 polyclonal antibody

Ref: AB-PAB20719
SDR42E1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SDR42E1.
Información adicional
Size 100 uL
Gene Name SDR42E1
Gene Alias HSPC105
Gene Description short chain dehydrogenase/reductase family 42E, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSEC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SDR42E1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93517
Iso type IgG

Enviar uma mensagem


SDR42E1 polyclonal antibody

SDR42E1 polyclonal antibody