TMCC2 polyclonal antibody
  • TMCC2 polyclonal antibody

TMCC2 polyclonal antibody

Ref: AB-PAB20702
TMCC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMCC2.
Información adicional
Size 100 uL
Gene Name TMCC2
Gene Alias FLJ38497|HUCEP11|KIAA0481
Gene Description transmembrane and coiled-coil domain family 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AARALSGSATLVSSPKYGSDDECSSASASSAGAGSNSGAGPGGALGSPKSNALYGAPGNLDALLEELREIKEGQSHLEDSMEDLKTQLQRDYTYMTQCLQEER
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMCC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9911
Iso type IgG

Enviar uma mensagem


TMCC2 polyclonal antibody

TMCC2 polyclonal antibody