TXNDC10 polyclonal antibody
  • TXNDC10 polyclonal antibody

TXNDC10 polyclonal antibody

Ref: AB-PAB20699
TXNDC10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNDC10.
Información adicional
Size 100 uL
Gene Name TXNDC10
Gene Alias FLJ20793|KIAA1830|TMX3
Gene Description thioredoxin domain containing 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXNDC10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54495
Iso type IgG

Enviar uma mensagem


TXNDC10 polyclonal antibody

TXNDC10 polyclonal antibody