SYPL1 polyclonal antibody
  • SYPL1 polyclonal antibody

SYPL1 polyclonal antibody

Ref: AB-PAB20698
SYPL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYPL1.
Información adicional
Size 100 uL
Gene Name SYPL1
Gene Alias H-SP1|SYPL
Gene Description synaptophysin-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ATGHNIIDELPPCKKKAVLCYFGSVTSMGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYPL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6856
Iso type IgG

Enviar uma mensagem


SYPL1 polyclonal antibody

SYPL1 polyclonal antibody