CHRM1 polyclonal antibody
  • CHRM1 polyclonal antibody

CHRM1 polyclonal antibody

Ref: AB-PAB20697
CHRM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHRM1.
Información adicional
Size 100 uL
Gene Name CHRM1
Gene Alias HM1|M1|MGC30125
Gene Description cholinergic receptor, muscarinic 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHRM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1128
Iso type IgG

Enviar uma mensagem


CHRM1 polyclonal antibody

CHRM1 polyclonal antibody