TMEM120B polyclonal antibody
  • TMEM120B polyclonal antibody

TMEM120B polyclonal antibody

Ref: AB-PAB20695
TMEM120B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM120B.
Información adicional
Size 100 uL
Gene Name TMEM120B
Gene Alias -
Gene Description transmembrane protein 120B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq THRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM120B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 144404
Iso type IgG

Enviar uma mensagem


TMEM120B polyclonal antibody

TMEM120B polyclonal antibody