CLEC4G polyclonal antibody
  • CLEC4G polyclonal antibody

CLEC4G polyclonal antibody

Ref: AB-PAB20691
CLEC4G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLEC4G.
Información adicional
Size 100 uL
Gene Name CLEC4G
Gene Alias LP2698|LSECtin|UNQ431
Gene Description C-type lectin domain family 4, member G
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLEC4G.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339390
Iso type IgG

Enviar uma mensagem


CLEC4G polyclonal antibody

CLEC4G polyclonal antibody