FUT11 polyclonal antibody
  • FUT11 polyclonal antibody

FUT11 polyclonal antibody

Ref: AB-PAB20689
FUT11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FUT11.
Información adicional
Size 100 uL
Gene Name FUT11
Gene Alias MGC119338|MGC119339|MGC33202
Gene Description fucosyltransferase 11 (alpha (1,3) fucosyltransferase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MKYLAYKQPGGITNQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIAQPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWDYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FUT11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 170384
Iso type IgG

Enviar uma mensagem


FUT11 polyclonal antibody

FUT11 polyclonal antibody