KANK4 polyclonal antibody
  • KANK4 polyclonal antibody

KANK4 polyclonal antibody

Ref: AB-PAB20688
KANK4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KANK4.
Información adicional
Size 100 uL
Gene Name KANK4
Gene Alias ANKRD38|FLJ10884|KIAA0172|RP5-1155K23.5|dJ1078M7.1
Gene Description KN motif and ankyrin repeat domains 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTDVMVNTDPVHGLLTRESCDKGIEVNLLGSMESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQGPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGTRGAGGFLWGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KANK4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163782
Iso type IgG

Enviar uma mensagem


KANK4 polyclonal antibody

KANK4 polyclonal antibody