RBM7 polyclonal antibody
  • RBM7 polyclonal antibody

RBM7 polyclonal antibody

Ref: AB-PAB20682
RBM7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM7.
Información adicional
Size 100 uL
Gene Name RBM7
Gene Alias FLJ11153
Gene Description RNA binding motif protein 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQW
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10179
Iso type IgG

Enviar uma mensagem


RBM7 polyclonal antibody

RBM7 polyclonal antibody