SLC6A9 polyclonal antibody
  • SLC6A9 polyclonal antibody

SLC6A9 polyclonal antibody

Ref: AB-PAB20681
SLC6A9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC6A9.
Información adicional
Size 100 uL
Gene Name SLC6A9
Gene Alias DKFZp547A1118|GLYT1
Gene Description solute carrier family 6 (neurotransmitter transporter, glycine), member 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC6A9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6536
Iso type IgG

Enviar uma mensagem


SLC6A9 polyclonal antibody

SLC6A9 polyclonal antibody