GABBR2 polyclonal antibody
  • GABBR2 polyclonal antibody

GABBR2 polyclonal antibody

Ref: AB-PAB20675
GABBR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GABBR2.
Información adicional
Size 100 uL
Gene Name GABBR2
Gene Alias FLJ36928|GABABR2|GPR51|GPRC3B|HG20|HRIHFB2099
Gene Description gamma-aminobutyric acid (GABA) B receptor, 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPI
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GABBR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9568
Iso type IgG

Enviar uma mensagem


GABBR2 polyclonal antibody

GABBR2 polyclonal antibody