C7orf53 polyclonal antibody
  • C7orf53 polyclonal antibody

C7orf53 polyclonal antibody

Ref: AB-PAB20671
C7orf53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf53.
Información adicional
Size 100 uL
Gene Name C7orf53
Gene Alias FLJ39575|MGC161427|MGC163440|MGC42850
Gene Description chromosome 7 open reading frame 53
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286006
Iso type IgG

Enviar uma mensagem


C7orf53 polyclonal antibody

C7orf53 polyclonal antibody