FAM110D polyclonal antibody
  • FAM110D polyclonal antibody

FAM110D polyclonal antibody

Ref: AB-PAB20668
FAM110D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM110D.
Información adicional
Size 100 uL
Gene Name FAM110D
Gene Alias GRRP1|RP11-96L14.5
Gene Description family with sequence similarity 110, member D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HQVIARRQEPALRGSPGPLTPHPCNELGPPASPRTPRPVRRGSGRRLPRPDSLIFYRQKRDC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM110D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79927
Iso type IgG

Enviar uma mensagem


FAM110D polyclonal antibody

FAM110D polyclonal antibody