WBSCR17 polyclonal antibody
  • WBSCR17 polyclonal antibody

WBSCR17 polyclonal antibody

Ref: AB-PAB20665
WBSCR17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WBSCR17.
Información adicional
Size 100 uL
Gene Name WBSCR17
Gene Alias DKFZp434I2216|DKFZp761D2324|GALNT16|GALNT20|GALNTL3
Gene Description Williams-Beuren syndrome chromosome region 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WBSCR17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64409
Iso type IgG

Enviar uma mensagem


WBSCR17 polyclonal antibody

WBSCR17 polyclonal antibody